Placeholder image of a protein
Icon representing a puzzle

1276: Revisiting Puzzle 68: Bos Taurus

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
August 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,903
  2. Avatar for freefolder 12. freefolder 1 pt. 8,858
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 8,588
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 8,274
  5. Avatar for Window Group 15. Window Group 1 pt. 5,381
  1. Avatar for ManVsYard 91. ManVsYard Lv 1 2 pts. 8,952
  2. Avatar for guineapig 92. guineapig Lv 1 2 pts. 8,929
  3. Avatar for kvasirthewise 93. kvasirthewise Lv 1 2 pts. 8,918
  4. Avatar for andrewxc 94. andrewxc Lv 1 2 pts. 8,912
  5. Avatar for BCAA 95. BCAA Lv 1 2 pts. 8,910
  6. Avatar for Arne Heessels 96. Arne Heessels Lv 1 2 pts. 8,907
  7. Avatar for aendgraend 97. aendgraend Lv 1 2 pts. 8,903
  8. Avatar for Deleted player 98. Deleted player pts. 8,898
  9. Avatar for leannerikicheever 99. leannerikicheever Lv 1 2 pts. 8,895
  10. Avatar for Deleted player 100. Deleted player pts. 8,890

Comments