Placeholder image of a protein
Icon representing a puzzle

1276: Revisiting Puzzle 68: Bos Taurus

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,903
  2. Avatar for freefolder 12. freefolder 1 pt. 8,858
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 8,588
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 8,274
  5. Avatar for Window Group 15. Window Group 1 pt. 5,381
  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 73 pts. 9,387
  2. Avatar for crpainter 12. crpainter Lv 1 71 pts. 9,386
  3. Avatar for smilingone 13. smilingone Lv 1 69 pts. 9,384
  4. Avatar for LociOiling 14. LociOiling Lv 1 66 pts. 9,383
  5. Avatar for g_b 15. g_b Lv 1 64 pts. 9,375
  6. Avatar for Galaxie 16. Galaxie Lv 1 62 pts. 9,371
  7. Avatar for Aubade01 17. Aubade01 Lv 1 60 pts. 9,371
  8. Avatar for Deleted player 18. Deleted player pts. 9,365
  9. Avatar for mimi 19. mimi Lv 1 56 pts. 9,365
  10. Avatar for O Seki To 20. O Seki To Lv 1 54 pts. 9,361

Comments