Placeholder image of a protein
Icon representing a puzzle

1276: Revisiting Puzzle 68: Bos Taurus

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,903
  2. Avatar for freefolder 12. freefolder 1 pt. 8,858
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 8,588
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 8,274
  5. Avatar for Window Group 15. Window Group 1 pt. 5,381
  1. Avatar for retiredmichael 21. retiredmichael Lv 1 52 pts. 9,360
  2. Avatar for mirp 22. mirp Lv 1 51 pts. 9,356
  3. Avatar for actiasluna 23. actiasluna Lv 1 49 pts. 9,354
  4. Avatar for Satina 24. Satina Lv 1 47 pts. 9,354
  5. Avatar for fiendish_ghoul 25. fiendish_ghoul Lv 1 46 pts. 9,352
  6. Avatar for Mark- 26. Mark- Lv 1 44 pts. 9,351
  7. Avatar for kabubi 27. kabubi Lv 1 42 pts. 9,339
  8. Avatar for Timo van der Laan 28. Timo van der Laan Lv 1 41 pts. 9,339
  9. Avatar for Bletchley Park 29. Bletchley Park Lv 1 39 pts. 9,338
  10. Avatar for Blipperman 30. Blipperman Lv 1 38 pts. 9,335

Comments