Placeholder image of a protein
Icon representing a puzzle

1276: Revisiting Puzzle 68: Bos Taurus

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,903
  2. Avatar for freefolder 12. freefolder 1 pt. 8,858
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 8,588
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 8,274
  5. Avatar for Window Group 15. Window Group 1 pt. 5,381
  1. Avatar for sheerbliss 61. sheerbliss Lv 1 11 pts. 9,211
  2. Avatar for aznarog 62. aznarog Lv 1 10 pts. 9,201
  3. Avatar for tarimo 63. tarimo Lv 1 10 pts. 9,197
  4. Avatar for Vinara 64. Vinara Lv 1 9 pts. 9,186
  5. Avatar for NinjaGreg 65. NinjaGreg Lv 1 9 pts. 9,185
  6. Avatar for stomjoh 66. stomjoh Lv 1 8 pts. 9,185
  7. Avatar for pfirth 67. pfirth Lv 1 8 pts. 9,180
  8. Avatar for jamiexq 68. jamiexq Lv 1 8 pts. 9,174
  9. Avatar for Merf 69. Merf Lv 1 7 pts. 9,165
  10. Avatar for jobo0502 70. jobo0502 Lv 1 7 pts. 9,154

Comments