Placeholder image of a protein
Icon representing a puzzle

1276: Revisiting Puzzle 68: Bos Taurus

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,903
  2. Avatar for freefolder 12. freefolder 1 pt. 8,858
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 8,588
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 8,274
  5. Avatar for Window Group 15. Window Group 1 pt. 5,381
  1. Avatar for carsonfb 71. carsonfb Lv 1 7 pts. 9,152
  2. Avatar for weitzen 72. weitzen Lv 1 6 pts. 9,141
  3. Avatar for Pagdzin 73. Pagdzin Lv 1 6 pts. 9,125
  4. Avatar for mitarcher 74. mitarcher Lv 1 6 pts. 9,120
  5. Avatar for phi16 75. phi16 Lv 1 5 pts. 9,119
  6. Avatar for Simek 76. Simek Lv 1 5 pts. 9,105
  7. Avatar for Anfinsen_slept_here 77. Anfinsen_slept_here Lv 1 5 pts. 9,103
  8. Avatar for diamonddays 78. diamonddays Lv 1 5 pts. 9,093
  9. Avatar for harvardman 79. harvardman Lv 1 4 pts. 9,084
  10. Avatar for TastyMunchies 80. TastyMunchies Lv 1 4 pts. 9,082

Comments