Placeholder image of a protein
Icon representing a puzzle

1276: Revisiting Puzzle 68: Bos Taurus

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,459
  2. Avatar for Contenders 2. Contenders 70 pts. 9,450
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 9,445
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,424
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 9,424
  6. Avatar for Go Science 6. Go Science 11 pts. 9,388
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 9,361
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,339
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 9,220
  10. Avatar for It's over 9000! 10. It's over 9000! 1 pt. 8,910

  1. Avatar for Norrjane 41. Norrjane Lv 1 25 pts. 9,292
  2. Avatar for Scopper 42. Scopper Lv 1 24 pts. 9,291
  3. Avatar for tomespen 43. tomespen Lv 1 23 pts. 9,287
  4. Avatar for JayD7217 44. JayD7217 Lv 1 22 pts. 9,285
  5. Avatar for randomlil 45. randomlil Lv 1 21 pts. 9,281
  6. Avatar for YeshuaLives 46. YeshuaLives Lv 1 20 pts. 9,273
  7. Avatar for Glen B 47. Glen B Lv 1 20 pts. 9,270
  8. Avatar for tallguy-13088 48. tallguy-13088 Lv 1 19 pts. 9,269
  9. Avatar for dssb 49. dssb Lv 1 18 pts. 9,266
  10. Avatar for Vredeman 50. Vredeman Lv 1 17 pts. 9,265

Comments