Placeholder image of a protein
Icon representing a puzzle

1276: Revisiting Puzzle 68: Bos Taurus

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,459
  2. Avatar for Contenders 2. Contenders 70 pts. 9,450
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 9,445
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,424
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 9,424
  6. Avatar for Go Science 6. Go Science 11 pts. 9,388
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 9,361
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,339
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 9,220
  10. Avatar for It's over 9000! 10. It's over 9000! 1 pt. 8,910
  1. Avatar for WBarme1234 51. WBarme1234 Lv 1 17 pts. 9,259
  2. Avatar for toshiue 52. toshiue Lv 1 16 pts. 9,255
  3. Avatar for altejoh 53. altejoh Lv 1 15 pts. 9,252
  4. Avatar for joremen 54. joremen Lv 1 14 pts. 9,251
  5. Avatar for Crossed Sticks 55. Crossed Sticks Lv 1 14 pts. 9,251
  6. Avatar for SKSbell 56. SKSbell Lv 1 13 pts. 9,246
  7. Avatar for dcrwheeler 57. dcrwheeler Lv 1 13 pts. 9,245
  8. Avatar for t012 58. t012 Lv 1 12 pts. 9,236
  9. Avatar for frood66 59. frood66 Lv 1 12 pts. 9,234
  10. Avatar for pmthomson90 60. pmthomson90 Lv 1 11 pts. 9,220

Comments