Placeholder image of a protein
Icon representing a puzzle

1277: Unsolved De-novo Freestyle 83: NMR Constraints

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 25, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1268, now with NMR torsion constraints! We have some experimental data from NMR spectroscopy that tells us about some structural propensities of this protein, but we don’t have a way to turn that data into a structure. Here we've included some of these data as torsional constraints, which constrain the backbone φ- and ψ-torsions of each residue. The constraints are reflected in the Backbone subscore; look for residues with with a bad Backbone score to find areas that need improvement! Some of the torsion constraints are suggestive of α-helices and β-sheets, which have been included in the starting structure for your convenience. Players will be able to load in manual saves from Puzzle 1268 and use them as a starting point here.



Sequence:


ENNAQTTNESAGQKVDSSMNKVGNFMDDSAITAKVKAALVDHDNIKSTDISVKTDQKVVTLSGFVESQAQAEEAVKVAKGVEGVTSVSDKLHVRDAKEGSVKGYAGDTATTSEIKAKLLADDIVPSRHVKVETTDGVVQLSGTVDSQAQSDRAESIAKAVDGVKSVKNDLKTK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 21,921
  2. Avatar for freefolder 12. freefolder 1 pt. 21,275
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 18,050
  4. Avatar for Team China 14. Team China 1 pt. 17,758
  5. Avatar for Skeptics Guide to the Universe 15. Skeptics Guide to the Universe 1 pt. 15,714
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,127
  7. Avatar for HMT heritage 17. HMT heritage 1 pt. 0
  1. Avatar for Anfinsen_slept_here 71. Anfinsen_slept_here Lv 1 8 pts. 22,032
  2. Avatar for hansvandenhof 72. hansvandenhof Lv 1 8 pts. 22,022
  3. Avatar for diamonddays 73. diamonddays Lv 1 8 pts. 22,018
  4. Avatar for JayD7217 74. JayD7217 Lv 1 7 pts. 22,000
  5. Avatar for johngran 75. johngran Lv 1 7 pts. 21,997
  6. Avatar for fryguy 76. fryguy Lv 1 7 pts. 21,978
  7. Avatar for georg137 77. georg137 Lv 1 6 pts. 21,971
  8. Avatar for dbuske 78. dbuske Lv 1 6 pts. 21,966
  9. Avatar for Cyberkashi 79. Cyberkashi Lv 1 6 pts. 21,947
  10. Avatar for SouperGenious 80. SouperGenious Lv 1 6 pts. 21,946

Comments

Skippysk8s Lv 1

I'd love to see a small puzzle with similar playing conditions. My machine is too small to have worked this puzzle and I feel left out of all the fun.
Good luck all
Skippy

Susume Lv 1

If this turns out to be a useful puzzle type (I hope it does!) it would be very helpful to be able to choose which subscore(s) to use for coloring. This is a feature that has been requested before, but I bring it up because it would enhance this puzzle so well.

tokens Lv 1

With the wide range of segment scores in this puzzle, it would also be nice to be able to choose the scaling of the coloring from red to green. Currently most of my protein is scoring bright green making it hard to decide which parts can be improved. Relative score coloring partly does this but I would like more control.