Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for :) 11. :) 2 pts. 9,173
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,151
  3. Avatar for xkcd 13. xkcd 1 pt. 9,045
  4. Avatar for freefolder 14. freefolder 1 pt. 9,027
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,005
  6. Avatar for Deleted group 16. Deleted group pts. 8,049
  7. Avatar for Deleted group 17. Deleted group pts. 4,699
  8. Avatar for Window Group 18. Window Group 1 pt. 4,699
  1. Avatar for Mr_Jolty 91. Mr_Jolty Lv 1 5 pts. 9,151
  2. Avatar for deLaCeiba 92. deLaCeiba Lv 1 5 pts. 9,147
  3. Avatar for navn 93. navn Lv 1 5 pts. 9,145
  4. Avatar for diamonddays 94. diamonddays Lv 1 5 pts. 9,142
  5. Avatar for rezaefar 95. rezaefar Lv 1 5 pts. 9,132
  6. Avatar for pfirth 96. pfirth Lv 1 4 pts. 9,129
  7. Avatar for tomespen 97. tomespen Lv 1 4 pts. 9,127
  8. Avatar for Deleted player 98. Deleted player pts. 9,127
  9. Avatar for mitarcher 99. mitarcher Lv 1 4 pts. 9,119
  10. Avatar for leehaggis 100. leehaggis Lv 1 4 pts. 9,118

Comments