Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for :) 11. :) 2 pts. 9,173
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,151
  3. Avatar for xkcd 13. xkcd 1 pt. 9,045
  4. Avatar for freefolder 14. freefolder 1 pt. 9,027
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,005
  6. Avatar for Deleted group 16. Deleted group pts. 8,049
  7. Avatar for Deleted group 17. Deleted group pts. 4,699
  8. Avatar for Window Group 18. Window Group 1 pt. 4,699
  1. Avatar for Satina 101. Satina Lv 1 4 pts. 9,113
  2. Avatar for bullmoose3 102. bullmoose3 Lv 1 3 pts. 9,094
  3. Avatar for harvardman 103. harvardman Lv 1 3 pts. 9,093
  4. Avatar for severin333 104. severin333 Lv 1 3 pts. 9,090
  5. Avatar for jamiexq 105. jamiexq Lv 1 3 pts. 9,087
  6. Avatar for demeter900 106. demeter900 Lv 1 3 pts. 9,083
  7. Avatar for pandapharmd 107. pandapharmd Lv 1 3 pts. 9,080
  8. Avatar for JUMELLE54 108. JUMELLE54 Lv 1 3 pts. 9,070
  9. Avatar for Altejos349 109. Altejos349 Lv 1 2 pts. 9,068
  10. Avatar for MadCat08 110. MadCat08 Lv 1 2 pts. 9,059

Comments