Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for :) 11. :) 2 pts. 9,173
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,151
  3. Avatar for xkcd 13. xkcd 1 pt. 9,045
  4. Avatar for freefolder 14. freefolder 1 pt. 9,027
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,005
  6. Avatar for Deleted group 16. Deleted group pts. 8,049
  7. Avatar for Deleted group 17. Deleted group pts. 4,699
  8. Avatar for Window Group 18. Window Group 1 pt. 4,699
  1. Avatar for ecali 111. ecali Lv 1 2 pts. 9,054
  2. Avatar for uihcv 112. uihcv Lv 1 2 pts. 9,050
  3. Avatar for fryguy 113. fryguy Lv 1 2 pts. 9,045
  4. Avatar for rinze 114. rinze Lv 1 2 pts. 9,043
  5. Avatar for dbuske 115. dbuske Lv 1 2 pts. 9,041
  6. Avatar for DotMatrix 116. DotMatrix Lv 1 2 pts. 9,038
  7. Avatar for Arne Heessels 117. Arne Heessels Lv 1 2 pts. 9,037
  8. Avatar for Ref_Jo 118. Ref_Jo Lv 1 2 pts. 9,030
  9. Avatar for Imeturoran 119. Imeturoran Lv 1 2 pts. 9,027
  10. Avatar for Hollinas 120. Hollinas Lv 1 2 pts. 9,025

Comments