Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for :) 11. :) 2 pts. 9,173
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,151
  3. Avatar for xkcd 13. xkcd 1 pt. 9,045
  4. Avatar for freefolder 14. freefolder 1 pt. 9,027
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,005
  6. Avatar for Deleted group 16. Deleted group pts. 8,049
  7. Avatar for Deleted group 17. Deleted group pts. 4,699
  8. Avatar for Window Group 18. Window Group 1 pt. 4,699
  1. Avatar for Tehnologik1 131. Tehnologik1 Lv 1 1 pt. 8,935
  2. Avatar for paulgene89 132. paulgene89 Lv 1 1 pt. 8,931
  3. Avatar for Iron pet 133. Iron pet Lv 1 1 pt. 8,923
  4. Avatar for martinf 134. martinf Lv 1 1 pt. 8,920
  5. Avatar for Inkedhands 135. Inkedhands Lv 1 1 pt. 8,912
  6. Avatar for Mike Cassidy 136. Mike Cassidy Lv 1 1 pt. 8,900
  7. Avatar for kvasirthewise 137. kvasirthewise Lv 1 1 pt. 8,891
  8. Avatar for DScott 138. DScott Lv 1 1 pt. 8,889
  9. Avatar for placid.lion 139. placid.lion Lv 1 1 pt. 8,889
  10. Avatar for shettler 140. shettler Lv 1 1 pt. 8,873

Comments