Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for :) 11. :) 2 pts. 9,173
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,151
  3. Avatar for xkcd 13. xkcd 1 pt. 9,045
  4. Avatar for freefolder 14. freefolder 1 pt. 9,027
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,005
  6. Avatar for Deleted group 16. Deleted group pts. 8,049
  7. Avatar for Deleted group 17. Deleted group pts. 4,699
  8. Avatar for Window Group 18. Window Group 1 pt. 4,699
  1. Avatar for emdee314 181. emdee314 Lv 1 1 pt. 8,283
  2. Avatar for ManVsYard 182. ManVsYard Lv 1 1 pt. 8,271
  3. Avatar for drumpeter18yrs9yrs 183. drumpeter18yrs9yrs Lv 1 1 pt. 8,049
  4. Avatar for Ashrai 184. Ashrai Lv 1 1 pt. 7,632
  5. Avatar for gremolata 185. gremolata Lv 1 1 pt. 7,438
  6. Avatar for Bautho 186. Bautho Lv 1 1 pt. 7,434
  7. Avatar for Ragheed99 187. Ragheed99 Lv 1 1 pt. 7,299
  8. Avatar for aterrag 188. aterrag Lv 1 1 pt. 7,027
  9. Avatar for marolidas 189. marolidas Lv 1 1 pt. 5,881
  10. Avatar for bidmiy2016 190. bidmiy2016 Lv 1 1 pt. 4,699

Comments