Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for :) 11. :) 2 pts. 9,173
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,151
  3. Avatar for xkcd 13. xkcd 1 pt. 9,045
  4. Avatar for freefolder 14. freefolder 1 pt. 9,027
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,005
  6. Avatar for Deleted group 16. Deleted group pts. 8,049
  7. Avatar for Deleted group 17. Deleted group pts. 4,699
  8. Avatar for Window Group 18. Window Group 1 pt. 4,699

  1. Avatar for fiendish_ghoul 11. fiendish_ghoul Lv 1 78 pts. 9,465
  2. Avatar for tokens 12. tokens Lv 1 76 pts. 9,463
  3. Avatar for Scopper 13. Scopper Lv 1 74 pts. 9,451
  4. Avatar for phi16 14. phi16 Lv 1 72 pts. 9,445
  5. Avatar for pauldunn 15. pauldunn Lv 1 70 pts. 9,434
  6. Avatar for LociOiling 16. LociOiling Lv 1 68 pts. 9,430
  7. Avatar for gmn 17. gmn Lv 1 66 pts. 9,428
  8. Avatar for pvc78 18. pvc78 Lv 1 64 pts. 9,424
  9. Avatar for Timo van der Laan 19. Timo van der Laan Lv 1 63 pts. 9,424
  10. Avatar for johnmitch 20. johnmitch Lv 1 61 pts. 9,416

Comments