Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for :) 11. :) 2 pts. 9,173
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,151
  3. Avatar for xkcd 13. xkcd 1 pt. 9,045
  4. Avatar for freefolder 14. freefolder 1 pt. 9,027
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,005
  6. Avatar for Deleted group 16. Deleted group pts. 8,049
  7. Avatar for Deleted group 17. Deleted group pts. 4,699
  8. Avatar for Window Group 18. Window Group 1 pt. 4,699
  1. Avatar for fishercat 21. fishercat Lv 1 59 pts. 9,414
  2. Avatar for pmdpmd 22. pmdpmd Lv 1 58 pts. 9,404
  3. Avatar for frood66 23. frood66 Lv 1 56 pts. 9,403
  4. Avatar for christioanchauvin 24. christioanchauvin Lv 1 55 pts. 9,402
  5. Avatar for crpainter 25. crpainter Lv 1 53 pts. 9,401
  6. Avatar for Deleted player 26. Deleted player pts. 9,399
  7. Avatar for Bletchley Park 27. Bletchley Park Lv 1 50 pts. 9,392
  8. Avatar for O Seki To 28. O Seki To Lv 1 49 pts. 9,392
  9. Avatar for Aubade01 29. Aubade01 Lv 1 47 pts. 9,387
  10. Avatar for Mike Lewis 30. Mike Lewis Lv 1 46 pts. 9,383

Comments