Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for :) 11. :) 2 pts. 9,173
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,151
  3. Avatar for xkcd 13. xkcd 1 pt. 9,045
  4. Avatar for freefolder 14. freefolder 1 pt. 9,027
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,005
  6. Avatar for Deleted group 16. Deleted group pts. 8,049
  7. Avatar for Deleted group 17. Deleted group pts. 4,699
  8. Avatar for Window Group 18. Window Group 1 pt. 4,699
  1. Avatar for Museka 51. Museka Lv 1 24 pts. 9,312
  2. Avatar for tallguy-13088 52. tallguy-13088 Lv 1 23 pts. 9,312
  3. Avatar for carsonfb 53. carsonfb Lv 1 22 pts. 9,301
  4. Avatar for Geyalust 54. Geyalust Lv 1 22 pts. 9,298
  5. Avatar for kabubi 55. kabubi Lv 1 21 pts. 9,297
  6. Avatar for Glen B 56. Glen B Lv 1 20 pts. 9,291
  7. Avatar for alwen 57. alwen Lv 1 20 pts. 9,287
  8. Avatar for Vinara 58. Vinara Lv 1 19 pts. 9,285
  9. Avatar for weitzen 59. weitzen Lv 1 18 pts. 9,284
  10. Avatar for TomTaylor 60. TomTaylor Lv 1 18 pts. 9,280

Comments