Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for :) 11. :) 2 pts. 9,173
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,151
  3. Avatar for xkcd 13. xkcd 1 pt. 9,045
  4. Avatar for freefolder 14. freefolder 1 pt. 9,027
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,005
  6. Avatar for Deleted group 16. Deleted group pts. 8,049
  7. Avatar for Deleted group 17. Deleted group pts. 4,699
  8. Avatar for Window Group 18. Window Group 1 pt. 4,699
  1. Avatar for MicElephant 61. MicElephant Lv 1 17 pts. 9,279
  2. Avatar for TastyMunchies 62. TastyMunchies Lv 1 17 pts. 9,278
  3. Avatar for Norrjane 63. Norrjane Lv 1 16 pts. 9,271
  4. Avatar for JayD7217 64. JayD7217 Lv 1 15 pts. 9,266
  5. Avatar for hansvandenhof 65. hansvandenhof Lv 1 15 pts. 9,260
  6. Avatar for caglar 66. caglar Lv 1 14 pts. 9,259
  7. Avatar for georg137 67. georg137 Lv 1 14 pts. 9,256
  8. Avatar for jermainiac 68. jermainiac Lv 1 13 pts. 9,250
  9. Avatar for eromana 69. eromana Lv 1 13 pts. 9,248
  10. Avatar for isaksson 70. isaksson Lv 1 12 pts. 9,247

Comments