Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for :) 11. :) 2 pts. 9,173
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,151
  3. Avatar for xkcd 13. xkcd 1 pt. 9,045
  4. Avatar for freefolder 14. freefolder 1 pt. 9,027
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,005
  6. Avatar for Deleted group 16. Deleted group pts. 8,049
  7. Avatar for Deleted group 17. Deleted group pts. 4,699
  8. Avatar for Window Group 18. Window Group 1 pt. 4,699
  1. Avatar for altejoh 71. altejoh Lv 1 12 pts. 9,246
  2. Avatar for BCAA 72. BCAA Lv 1 12 pts. 9,245
  3. Avatar for bx7gn 73. bx7gn Lv 1 11 pts. 9,245
  4. Avatar for stomjoh 74. stomjoh Lv 1 11 pts. 9,243
  5. Avatar for NinjaGreg 75. NinjaGreg Lv 1 10 pts. 9,238
  6. Avatar for sharondipity 76. sharondipity Lv 1 10 pts. 9,235
  7. Avatar for ViJay7019 77. ViJay7019 Lv 1 10 pts. 9,222
  8. Avatar for mimi 78. mimi Lv 1 9 pts. 9,222
  9. Avatar for guineapig 79. guineapig Lv 1 9 pts. 9,220
  10. Avatar for froggs554 80. froggs554 Lv 1 8 pts. 9,214

Comments