Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for :) 11. :) 2 pts. 9,173
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,151
  3. Avatar for xkcd 13. xkcd 1 pt. 9,045
  4. Avatar for freefolder 14. freefolder 1 pt. 9,027
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,005
  6. Avatar for Deleted group 16. Deleted group pts. 8,049
  7. Avatar for Deleted group 17. Deleted group pts. 4,699
  8. Avatar for Window Group 18. Window Group 1 pt. 4,699
  1. Avatar for johngran 81. johngran Lv 1 8 pts. 9,204
  2. Avatar for jebbiek 82. jebbiek Lv 1 8 pts. 9,202
  3. Avatar for tarimo 83. tarimo Lv 1 8 pts. 9,201
  4. Avatar for SouperGenious 84. SouperGenious Lv 1 7 pts. 9,190
  5. Avatar for Jim Fraser 85. Jim Fraser Lv 1 7 pts. 9,185
  6. Avatar for Merf 86. Merf Lv 1 7 pts. 9,184
  7. Avatar for sheerbliss 87. sheerbliss Lv 1 6 pts. 9,176
  8. Avatar for machinelves 88. machinelves Lv 1 6 pts. 9,173
  9. Avatar for bendbob 89. bendbob Lv 1 6 pts. 9,163
  10. Avatar for Alistair69 90. Alistair69 Lv 1 6 pts. 9,152

Comments