Placeholder image of a protein
Icon representing a puzzle

1283: Unsolved De-novo Freestyle 86

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
September 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RLDELEELKKELEKDRERWEKQTTSSHLEELKKELEKLKKELEKMKGDQTEHRFRTRYRTDTSEYEVEIEITDGQTRMRSREHSR

Top groups


  1. Avatar for freefolder 11. freefolder 1 pt. 8,745
  2. Avatar for :) 12. :) 1 pt. 8,608
  3. Avatar for NanobotsUU2016 13. NanobotsUU2016 1 pt. 6,473
  4. Avatar for CureCoin 14. CureCoin 1 pt. 6,445
  5. Avatar for Biology 2 15. Biology 2 1 pt. 5,965
  6. Avatar for Deleted group 16. Deleted group pts. 5,955
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,746

  1. Avatar for smcclosk 151. smcclosk Lv 1 1 pt. 6,477
  2. Avatar for DanC2016 152. DanC2016 Lv 1 1 pt. 6,473
  3. Avatar for wilding2004 153. wilding2004 Lv 1 1 pt. 6,445
  4. Avatar for Vinitski 154. Vinitski Lv 1 1 pt. 6,319
  5. Avatar for FalconSolver 155. FalconSolver Lv 1 1 pt. 6,282
  6. Avatar for Nicky Wojtania 156. Nicky Wojtania Lv 1 1 pt. 6,198
  7. Avatar for nick.m 158. nick.m Lv 1 1 pt. 6,042
  8. Avatar for fluffykitty 159. fluffykitty Lv 1 1 pt. 6,037
  9. Avatar for baughc 160. baughc Lv 1 1 pt. 5,965

Comments