Placeholder image of a protein
Icon representing a puzzle

1283: Unsolved De-novo Freestyle 86

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
September 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RLDELEELKKELEKDRERWEKQTTSSHLEELKKELEKLKKELEKMKGDQTEHRFRTRYRTDTSEYEVEIEITDGQTRMRSREHSR

Top groups


  1. Avatar for freefolder 11. freefolder 1 pt. 8,745
  2. Avatar for :) 12. :) 1 pt. 8,608
  3. Avatar for NanobotsUU2016 13. NanobotsUU2016 1 pt. 6,473
  4. Avatar for CureCoin 14. CureCoin 1 pt. 6,445
  5. Avatar for Biology 2 15. Biology 2 1 pt. 5,965
  6. Avatar for Deleted group 16. Deleted group pts. 5,955
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,746

  1. Avatar for Icecarbonate 171. Icecarbonate Lv 1 1 pt. 5,679
  2. Avatar for Gwing16 172. Gwing16 Lv 1 1 pt. 5,315
  3. Avatar for xplocast1 173. xplocast1 Lv 1 1 pt. 5,250
  4. Avatar for jscalves 174. jscalves Lv 1 1 pt. 5,197
  5. Avatar for fishercat 176. fishercat Lv 1 1 pt. 4,197
  6. Avatar for Blitzghost 177. Blitzghost Lv 1 1 pt. 3,872
  7. Avatar for gslee3134 178. gslee3134 Lv 1 1 pt. 2,321
  8. Avatar for 01010011111 179. 01010011111 Lv 1 1 pt. 0
  9. Avatar for zkk518 180. zkk518 Lv 1 1 pt. 0

Comments