Placeholder image of a protein
Icon representing a puzzle

1283: Unsolved De-novo Freestyle 86

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
September 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RLDELEELKKELEKDRERWEKQTTSSHLEELKKELEKLKKELEKMKGDQTEHRFRTRYRTDTSEYEVEIEITDGQTRMRSREHSR

Top groups


  1. Avatar for freefolder 11. freefolder 1 pt. 8,745
  2. Avatar for :) 12. :) 1 pt. 8,608
  3. Avatar for NanobotsUU2016 13. NanobotsUU2016 1 pt. 6,473
  4. Avatar for CureCoin 14. CureCoin 1 pt. 6,445
  5. Avatar for Biology 2 15. Biology 2 1 pt. 5,965
  6. Avatar for Deleted group 16. Deleted group pts. 5,955
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,746

  1. Avatar for Geigersc 181. Geigersc Lv 1 1 pt. 0
  2. Avatar for p1639hj 182. p1639hj Lv 1 1 pt. 0
  3. Avatar for wyattj 183. wyattj Lv 1 1 pt. 0
  4. Avatar for eromana 185. eromana Lv 1 1 pt. 0
  5. Avatar for BroC4 187. BroC4 Lv 1 1 pt. 0
  6. Avatar for Paulo Roque 188. Paulo Roque Lv 1 1 pt. 0
  7. Avatar for Dempy 189. Dempy Lv 1 1 pt. 0
  8. Avatar for spvincent 190. spvincent Lv 1 1 pt. 0

Comments