Placeholder image of a protein
Icon representing a puzzle

1283: Unsolved De-novo Freestyle 86

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RLDELEELKKELEKDRERWEKQTTSSHLEELKKELEKLKKELEKMKGDQTEHRFRTRYRTDTSEYEVEIEITDGQTRMRSREHSR

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,745
  2. Avatar for :) 12. :) 1 pt. 8,608
  3. Avatar for NanobotsUU2016 13. NanobotsUU2016 1 pt. 6,473
  4. Avatar for CureCoin 14. CureCoin 1 pt. 6,445
  5. Avatar for Biology 2 15. Biology 2 1 pt. 5,965
  6. Avatar for Deleted group 16. Deleted group pts. 5,955
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,746
  1. Avatar for Vinara 21. Vinara Lv 1 58 pts. 9,495
  2. Avatar for gitwut 22. gitwut Lv 1 57 pts. 9,467
  3. Avatar for Scopper 23. Scopper Lv 1 55 pts. 9,464
  4. Avatar for Museka 24. Museka Lv 1 54 pts. 9,460
  5. Avatar for christioanchauvin 25. christioanchauvin Lv 1 52 pts. 9,459
  6. Avatar for phi16 26. phi16 Lv 1 50 pts. 9,437
  7. Avatar for mimi 27. mimi Lv 1 49 pts. 9,437
  8. Avatar for shettler 28. shettler Lv 1 48 pts. 9,411
  9. Avatar for Mike Cassidy 29. Mike Cassidy Lv 1 46 pts. 9,409
  10. Avatar for Madde 30. Madde Lv 1 45 pts. 9,408

Comments