Placeholder image of a protein
Icon representing a puzzle

1283: Unsolved De-novo Freestyle 86

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RLDELEELKKELEKDRERWEKQTTSSHLEELKKELEKLKKELEKMKGDQTEHRFRTRYRTDTSEYEVEIEITDGQTRMRSREHSR

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,731
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,716
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,682
  4. Avatar for Contenders 4. Contenders 36 pts. 9,640
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 9,550
  6. Avatar for Go Science 6. Go Science 16 pts. 9,464
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,460
  8. Avatar for Deleted group 8. Deleted group pts. 9,304
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,298
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,806

  1. Avatar for drumpeter18yrs9yrs 101. drumpeter18yrs9yrs Lv 1 3 pts. 8,500
  2. Avatar for Bautho 102. Bautho Lv 1 3 pts. 8,493
  3. Avatar for Jim Fraser 103. Jim Fraser Lv 1 3 pts. 8,483
  4. Avatar for angeltrouble 104. angeltrouble Lv 1 3 pts. 8,453
  5. Avatar for tarimo 105. tarimo Lv 1 3 pts. 8,449
  6. Avatar for Cyberkashi 106. Cyberkashi Lv 1 2 pts. 8,414
  7. Avatar for froggs554 107. froggs554 Lv 1 2 pts. 8,403
  8. Avatar for Ref_Jo 108. Ref_Jo Lv 1 2 pts. 8,398
  9. Avatar for parsnip 109. parsnip Lv 1 2 pts. 8,386
  10. Avatar for mitarcher 110. mitarcher Lv 1 2 pts. 8,385

Comments