Placeholder image of a protein
Icon representing a puzzle

1286: Unsolved De-novo Freestyle 87

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 16, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEEEIKKEIEKIKEWFKKGEGGYRLEINEDGREIEVEIRSEGTLRIRLDNVHEELKKEFEKLKEEWKKIK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,138
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,057
  3. Avatar for xkcd 13. xkcd 1 pt. 8,985
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,908
  5. Avatar for CHNO Junkies 15. CHNO Junkies 1 pt. 8,828
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,447
  7. Avatar for USD_IMB 17. USD_IMB 1 pt. 7,557
  8. Avatar for Cannabis Crew 18. Cannabis Crew 1 pt. 6,654
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 4,307
  1. Avatar for MicElephant 101. MicElephant Lv 1 10 pts. 8,726
  2. Avatar for peterstumpf 102. peterstumpf Lv 1 9 pts. 8,726
  3. Avatar for Psych0Active 103. Psych0Active Lv 1 9 pts. 8,712
  4. Avatar for pfirth 104. pfirth Lv 1 9 pts. 8,709
  5. Avatar for bx7gn 105. bx7gn Lv 1 8 pts. 8,682
  6. Avatar for Norrjane 106. Norrjane Lv 1 8 pts. 8,678
  7. Avatar for manu8170 107. manu8170 Lv 1 8 pts. 8,677
  8. Avatar for SKSbell 108. SKSbell Lv 1 8 pts. 8,670
  9. Avatar for Hansie 109. Hansie Lv 1 8 pts. 8,646
  10. Avatar for Arne Heessels 110. Arne Heessels Lv 1 7 pts. 8,621

Comments