Placeholder image of a protein
Icon representing a puzzle

1286: Unsolved De-novo Freestyle 87

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 16, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEEEIKKEIEKIKEWFKKGEGGYRLEINEDGREIEVEIRSEGTLRIRLDNVHEELKKEFEKLKEEWKKIK

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,657
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,655
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 9,642
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 9,640
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,481
  6. Avatar for Go Science 6. Go Science 20 pts. 9,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,354
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,168
  9. Avatar for freefolder 9. freefolder 6 pts. 9,161
  10. Avatar for Deleted group 10. Deleted group pts. 9,139
  1. Avatar for MicElephant 101. MicElephant Lv 1 10 pts. 8,726
  2. Avatar for peterstumpf 102. peterstumpf Lv 1 9 pts. 8,726
  3. Avatar for Psych0Active 103. Psych0Active Lv 1 9 pts. 8,712
  4. Avatar for pfirth 104. pfirth Lv 1 9 pts. 8,709
  5. Avatar for bx7gn 105. bx7gn Lv 1 8 pts. 8,682
  6. Avatar for Norrjane 106. Norrjane Lv 1 8 pts. 8,678
  7. Avatar for manu8170 107. manu8170 Lv 1 8 pts. 8,677
  8. Avatar for SKSbell 108. SKSbell Lv 1 8 pts. 8,670
  9. Avatar for Hansie 109. Hansie Lv 1 8 pts. 8,646
  10. Avatar for Arne Heessels 110. Arne Heessels Lv 1 7 pts. 8,621

Comments