Placeholder image of a protein
Icon representing a puzzle

1286: Unsolved De-novo Freestyle 87

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 16, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEEEIKKEIEKIKEWFKKGEGGYRLEINEDGREIEVEIRSEGTLRIRLDNVHEELKKEFEKLKEEWKKIK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,138
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,057
  3. Avatar for xkcd 13. xkcd 1 pt. 8,985
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,908
  5. Avatar for CHNO Junkies 15. CHNO Junkies 1 pt. 8,828
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,447
  7. Avatar for USD_IMB 17. USD_IMB 1 pt. 7,557
  8. Avatar for Cannabis Crew 18. Cannabis Crew 1 pt. 6,654
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 4,307
  1. Avatar for diamonddays 81. diamonddays Lv 1 17 pts. 8,923
  2. Avatar for BCAA 82. BCAA Lv 1 16 pts. 8,908
  3. Avatar for heather-1 83. heather-1 Lv 1 16 pts. 8,906
  4. Avatar for WBarme1234 84. WBarme1234 Lv 1 15 pts. 8,896
  5. Avatar for Anfinsen_slept_here 85. Anfinsen_slept_here Lv 1 15 pts. 8,886
  6. Avatar for JayD7217 86. JayD7217 Lv 1 15 pts. 8,885
  7. Avatar for YGK 87. YGK Lv 1 14 pts. 8,883
  8. Avatar for alcor29 88. alcor29 Lv 1 14 pts. 8,871
  9. Avatar for Merf 89. Merf Lv 1 13 pts. 8,868
  10. Avatar for ivalnic 90. ivalnic Lv 1 13 pts. 8,863

Comments