Placeholder image of a protein
Icon representing a puzzle

1286: Unsolved De-novo Freestyle 87

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 16, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEEEIKKEIEKIKEWFKKGEGGYRLEINEDGREIEVEIRSEGTLRIRLDNVHEELKKEFEKLKEEWKKIK

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,657
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,655
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 9,642
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 9,640
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,481
  6. Avatar for Go Science 6. Go Science 20 pts. 9,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,354
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,168
  9. Avatar for freefolder 9. freefolder 6 pts. 9,161
  10. Avatar for Deleted group 10. Deleted group pts. 9,139
  1. Avatar for diamonddays 81. diamonddays Lv 1 17 pts. 8,923
  2. Avatar for BCAA 82. BCAA Lv 1 16 pts. 8,908
  3. Avatar for heather-1 83. heather-1 Lv 1 16 pts. 8,906
  4. Avatar for WBarme1234 84. WBarme1234 Lv 1 15 pts. 8,896
  5. Avatar for Anfinsen_slept_here 85. Anfinsen_slept_here Lv 1 15 pts. 8,886
  6. Avatar for JayD7217 86. JayD7217 Lv 1 15 pts. 8,885
  7. Avatar for YGK 87. YGK Lv 1 14 pts. 8,883
  8. Avatar for alcor29 88. alcor29 Lv 1 14 pts. 8,871
  9. Avatar for Merf 89. Merf Lv 1 13 pts. 8,868
  10. Avatar for ivalnic 90. ivalnic Lv 1 13 pts. 8,863

Comments