Placeholder image of a protein
Icon representing a puzzle

1286: Unsolved De-novo Freestyle 87

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 16, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEEEIKKEIEKIKEWFKKGEGGYRLEINEDGREIEVEIRSEGTLRIRLDNVHEELKKEFEKLKEEWKKIK

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,657
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,655
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 9,642
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 9,640
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,481
  6. Avatar for Go Science 6. Go Science 20 pts. 9,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,354
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,168
  9. Avatar for freefolder 9. freefolder 6 pts. 9,161
  10. Avatar for Deleted group 10. Deleted group pts. 9,139
  1. Avatar for rezaefar 161. rezaefar Lv 1 1 pt. 7,889
  2. Avatar for Elviraah 162. Elviraah Lv 1 1 pt. 7,887
  3. Avatar for Chappyroo 163. Chappyroo Lv 1 1 pt. 7,881
  4. Avatar for randomlil 164. randomlil Lv 1 1 pt. 7,853
  5. Avatar for dixonws2 165. dixonws2 Lv 1 1 pt. 7,819
  6. Avatar for Igor_Holowacz 166. Igor_Holowacz Lv 1 1 pt. 7,796
  7. Avatar for heyubob 167. heyubob Lv 1 1 pt. 7,779
  8. Avatar for Zamox 168. Zamox Lv 1 1 pt. 7,757
  9. Avatar for sor2018 169. sor2018 Lv 1 1 pt. 7,751
  10. Avatar for AcidEaterr 170. AcidEaterr Lv 1 1 pt. 7,683

Comments