Placeholder image of a protein
Icon representing a puzzle

1286: Unsolved De-novo Freestyle 87

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 16, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEEEIKKEIEKIKEWFKKGEGGYRLEINEDGREIEVEIRSEGTLRIRLDNVHEELKKEFEKLKEEWKKIK

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,657
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,655
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 9,642
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 9,640
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,481
  6. Avatar for Go Science 6. Go Science 20 pts. 9,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,354
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,168
  9. Avatar for freefolder 9. freefolder 6 pts. 9,161
  10. Avatar for Deleted group 10. Deleted group pts. 9,139
  1. Avatar for bhodg1 141. bhodg1 Lv 1 3 pts. 8,158
  2. Avatar for donckypoop 142. donckypoop Lv 1 3 pts. 8,148
  3. Avatar for Sydefecks 143. Sydefecks Lv 1 3 pts. 8,118
  4. Avatar for RestrictionEndoNykolease 144. RestrictionEndoNykolease Lv 1 2 pts. 8,039
  5. Avatar for iceslayer 145. iceslayer Lv 1 2 pts. 8,034
  6. Avatar for DraKoan 146. DraKoan Lv 1 2 pts. 8,021
  7. Avatar for koewaffle 147. koewaffle Lv 1 2 pts. 8,020
  8. Avatar for Rated.Em 148. Rated.Em Lv 1 2 pts. 8,013
  9. Avatar for sa_simsalabim 149. sa_simsalabim Lv 1 2 pts. 8,013
  10. Avatar for tweak64 150. tweak64 Lv 1 2 pts. 8,004

Comments