Placeholder image of a protein
Icon representing a puzzle

1286: Unsolved De-novo Freestyle 87

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 16, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEEEIKKEIEKIKEWFKKGEGGYRLEINEDGREIEVEIRSEGTLRIRLDNVHEELKKEFEKLKEEWKKIK

Top groups


  1. Avatar for Contenders 100 pts. 9,657
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,655
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 9,642
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 9,640
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,481
  6. Avatar for Go Science 6. Go Science 20 pts. 9,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,354
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,168
  9. Avatar for freefolder 9. freefolder 6 pts. 9,161
  10. Avatar for Deleted group 10. Deleted group pts. 9,139

  1. Avatar for jobo0502 41. jobo0502 Lv 1 44 pts. 9,223
  2. Avatar for Roukess67 42. Roukess67 Lv 1 43 pts. 9,222
  3. Avatar for Bautho 43. Bautho Lv 1 42 pts. 9,221
  4. Avatar for hansvandenhof 44. hansvandenhof Lv 1 41 pts. 9,217
  5. Avatar for grogar7 45. grogar7 Lv 1 40 pts. 9,212
  6. Avatar for joremen 46. joremen Lv 1 39 pts. 9,206
  7. Avatar for crpainter 47. crpainter Lv 1 39 pts. 9,204
  8. Avatar for wisky 48. wisky Lv 1 38 pts. 9,189
  9. Avatar for isaksson 49. isaksson Lv 1 37 pts. 9,179
  10. Avatar for O Seki To 50. O Seki To Lv 1 36 pts. 9,168

Comments