Placeholder image of a protein
Icon representing a puzzle

1287: Revisiting Puzzle 71 with Density: Crystallin

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
September 21, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Russian team 11. Russian team 5 pts. 9,612
  2. Avatar for It's over 9000! 12. It's over 9000! 4 pts. 9,599
  3. Avatar for xkcd 13. xkcd 2 pts. 9,516
  4. Avatar for SETI.Germany 14. SETI.Germany 2 pts. 9,326
  5. Avatar for USD_IMB 15. USD_IMB 1 pt. 9,115
  6. Avatar for Lakeland BIO353 16. Lakeland BIO353 1 pt. 8,565
  7. Avatar for Rice Biochemistry 17. Rice Biochemistry 1 pt. 8,525
  8. Avatar for freefolder 18. freefolder 1 pt. 8,336
  9. Avatar for Skidmore CH 341 19. Skidmore CH 341 1 pt. 8,191
  10. Avatar for Window Group 20. Window Group 1 pt. 7,949

  1. Avatar for Satina 91. Satina Lv 1 11 pts. 9,822
  2. Avatar for Madde 92. Madde Lv 1 11 pts. 9,815
  3. Avatar for gcm24 93. gcm24 Lv 1 11 pts. 9,815
  4. Avatar for SKSbell 94. SKSbell Lv 1 10 pts. 9,812
  5. Avatar for jamiexq 95. jamiexq Lv 1 10 pts. 9,799
  6. Avatar for bx7gn 96. bx7gn Lv 1 10 pts. 9,776
  7. Avatar for Iron pet 97. Iron pet Lv 1 9 pts. 9,752
  8. Avatar for Sci1217 98. Sci1217 Lv 1 9 pts. 9,689
  9. Avatar for Mike Cassidy 99. Mike Cassidy Lv 1 9 pts. 9,652
  10. Avatar for mitarcher 100. mitarcher Lv 1 9 pts. 9,627

Comments