Placeholder image of a protein
Icon representing a puzzle

1287: Revisiting Puzzle 71 with Density: Crystallin

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
September 21, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Russian team 11. Russian team 5 pts. 9,612
  2. Avatar for It's over 9000! 12. It's over 9000! 4 pts. 9,599
  3. Avatar for xkcd 13. xkcd 2 pts. 9,516
  4. Avatar for SETI.Germany 14. SETI.Germany 2 pts. 9,326
  5. Avatar for USD_IMB 15. USD_IMB 1 pt. 9,115
  6. Avatar for Lakeland BIO353 16. Lakeland BIO353 1 pt. 8,565
  7. Avatar for Rice Biochemistry 17. Rice Biochemistry 1 pt. 8,525
  8. Avatar for freefolder 18. freefolder 1 pt. 8,336
  9. Avatar for Skidmore CH 341 19. Skidmore CH 341 1 pt. 8,191
  10. Avatar for Window Group 20. Window Group 1 pt. 7,949

  1. Avatar for Jojo2205 151. Jojo2205 Lv 1 2 pts. 9,161
  2. Avatar for lamoille 152. lamoille Lv 1 1 pt. 9,152
  3. Avatar for Grainman 153. Grainman Lv 1 1 pt. 9,151
  4. Avatar for Kiwegapa 154. Kiwegapa Lv 1 1 pt. 9,131
  5. Avatar for saksoft2 155. saksoft2 Lv 1 1 pt. 9,130
  6. Avatar for puy0 156. puy0 Lv 1 1 pt. 9,126
  7. Avatar for wolfy959 157. wolfy959 Lv 1 1 pt. 9,117
  8. Avatar for broccoli.usd 158. broccoli.usd Lv 1 1 pt. 9,115
  9. Avatar for NotJim99 159. NotJim99 Lv 1 1 pt. 9,091
  10. Avatar for lockert 160. lockert Lv 1 1 pt. 9,076

Comments