Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,880
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,841
  3. Avatar for xkcd 13. xkcd 2 pts. 8,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,712
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,618
  6. Avatar for Sirius 2016 01 16. Sirius 2016 01 1 pt. 8,494
  7. Avatar for Bad Monkey 17. Bad Monkey 1 pt. 8,191
  8. Avatar for freefolder 18. freefolder 1 pt. 8,127
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 8,076
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 7,897

  1. Avatar for joaniegirl 161. joaniegirl Lv 1 1 pt. 8,298
  2. Avatar for chaoseclipse01 162. chaoseclipse01 Lv 1 1 pt. 8,297
  3. Avatar for dikech 163. dikech Lv 1 1 pt. 8,289
  4. Avatar for Pyotr 164. Pyotr Lv 1 1 pt. 8,288
  5. Avatar for bendbob 165. bendbob Lv 1 1 pt. 8,255
  6. Avatar for kvasirthewise 166. kvasirthewise Lv 1 1 pt. 8,249
  7. Avatar for krisha_lim 167. krisha_lim Lv 1 1 pt. 8,211
  8. Avatar for NotJim99 168. NotJim99 Lv 1 1 pt. 8,208
  9. Avatar for Gleb Ptitsyn 169. Gleb Ptitsyn Lv 1 1 pt. 8,198
  10. Avatar for brenejohn 170. brenejohn Lv 1 1 pt. 8,191

Comments