Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,397
  2. Avatar for Contenders 2. Contenders 78 pts. 9,358
  3. Avatar for Go Science 3. Go Science 60 pts. 9,322
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,311
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 9,286
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 24 pts. 9,246
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 9,229
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,132
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 9,101
  10. Avatar for Russian team 10. Russian team 6 pts. 8,921
  1. Avatar for joaniegirl 161. joaniegirl Lv 1 1 pt. 8,298
  2. Avatar for chaoseclipse01 162. chaoseclipse01 Lv 1 1 pt. 8,297
  3. Avatar for dikech 163. dikech Lv 1 1 pt. 8,289
  4. Avatar for Pyotr 164. Pyotr Lv 1 1 pt. 8,288
  5. Avatar for bendbob 165. bendbob Lv 1 1 pt. 8,255
  6. Avatar for kvasirthewise 166. kvasirthewise Lv 1 1 pt. 8,249
  7. Avatar for krisha_lim 167. krisha_lim Lv 1 1 pt. 8,211
  8. Avatar for NotJim99 168. NotJim99 Lv 1 1 pt. 8,208
  9. Avatar for Gleb Ptitsyn 169. Gleb Ptitsyn Lv 1 1 pt. 8,198
  10. Avatar for brenejohn 170. brenejohn Lv 1 1 pt. 8,191

Comments