Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,880
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,841
  3. Avatar for xkcd 13. xkcd 2 pts. 8,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,712
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,618
  6. Avatar for Sirius 2016 01 16. Sirius 2016 01 1 pt. 8,494
  7. Avatar for Bad Monkey 17. Bad Monkey 1 pt. 8,191
  8. Avatar for freefolder 18. freefolder 1 pt. 8,127
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 8,076
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 7,897

  1. Avatar for hajtogato 181. hajtogato Lv 1 1 pt. 8,089
  2. Avatar for aspadistra 182. aspadistra Lv 1 1 pt. 8,076
  3. Avatar for nagistick 183. nagistick Lv 1 1 pt. 8,070
  4. Avatar for cnhrcolemam 184. cnhrcolemam Lv 1 1 pt. 8,047
  5. Avatar for momadoc 185. momadoc Lv 1 1 pt. 8,033
  6. Avatar for MonsterPhil 186. MonsterPhil Lv 1 1 pt. 8,027
  7. Avatar for KatiaZ 187. KatiaZ Lv 1 1 pt. 8,015
  8. Avatar for Ignition_Switch 188. Ignition_Switch Lv 1 1 pt. 8,012
  9. Avatar for Blockhead2 189. Blockhead2 Lv 1 1 pt. 8,010
  10. Avatar for dojennus 190. dojennus Lv 1 1 pt. 8,009

Comments