Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Beta Folders 100 pts. 9,397
  2. Avatar for Contenders 2. Contenders 78 pts. 9,358
  3. Avatar for Go Science 3. Go Science 60 pts. 9,322
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,311
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 9,286
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 24 pts. 9,246
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 9,229
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,132
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 9,101
  10. Avatar for Russian team 10. Russian team 6 pts. 8,921

  1. Avatar for hajtogato 181. hajtogato Lv 1 1 pt. 8,089
  2. Avatar for aspadistra 182. aspadistra Lv 1 1 pt. 8,076
  3. Avatar for nagistick 183. nagistick Lv 1 1 pt. 8,070
  4. Avatar for cnhrcolemam 184. cnhrcolemam Lv 1 1 pt. 8,047
  5. Avatar for momadoc 185. momadoc Lv 1 1 pt. 8,033
  6. Avatar for MonsterPhil 186. MonsterPhil Lv 1 1 pt. 8,027
  7. Avatar for KatiaZ 187. KatiaZ Lv 1 1 pt. 8,015
  8. Avatar for Ignition_Switch 188. Ignition_Switch Lv 1 1 pt. 8,012
  9. Avatar for Blockhead2 189. Blockhead2 Lv 1 1 pt. 8,010
  10. Avatar for dojennus 190. dojennus Lv 1 1 pt. 8,009

Comments