Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,880
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,841
  3. Avatar for xkcd 13. xkcd 2 pts. 8,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,712
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,618
  6. Avatar for Sirius 2016 01 16. Sirius 2016 01 1 pt. 8,494
  7. Avatar for Bad Monkey 17. Bad Monkey 1 pt. 8,191
  8. Avatar for freefolder 18. freefolder 1 pt. 8,127
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 8,076
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 7,897
  1. Avatar for Minto 211. Minto Lv 1 1 pt. 7,430
  2. Avatar for Hans Sprungfeld 212. Hans Sprungfeld Lv 1 1 pt. 7,399
  3. Avatar for gerta93 213. gerta93 Lv 1 1 pt. 7,339
  4. Avatar for james_ss105 214. james_ss105 Lv 1 1 pt. 7,289
  5. Avatar for Nietuzinkowy123 215. Nietuzinkowy123 Lv 1 1 pt. 7,041
  6. Avatar for jflat06 216. jflat06 Lv 1 1 pt. 6,614
  7. Avatar for emtonsti 217. emtonsti Lv 1 1 pt. 5,630
  8. Avatar for CRISPRLovers 218. CRISPRLovers Lv 1 1 pt. 5,630
  9. Avatar for heather-1 219. heather-1 Lv 1 1 pt. 5,630
  10. Avatar for HiddenMoon 220. HiddenMoon Lv 1 1 pt. 5,630

Comments