Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,397
  2. Avatar for Contenders 2. Contenders 78 pts. 9,358
  3. Avatar for Go Science 3. Go Science 60 pts. 9,322
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,311
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 9,286
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 24 pts. 9,246
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 9,229
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,132
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 9,101
  10. Avatar for Russian team 10. Russian team 6 pts. 8,921
  1. Avatar for Minto 211. Minto Lv 1 1 pt. 7,430
  2. Avatar for Hans Sprungfeld 212. Hans Sprungfeld Lv 1 1 pt. 7,399
  3. Avatar for gerta93 213. gerta93 Lv 1 1 pt. 7,339
  4. Avatar for james_ss105 214. james_ss105 Lv 1 1 pt. 7,289
  5. Avatar for Nietuzinkowy123 215. Nietuzinkowy123 Lv 1 1 pt. 7,041
  6. Avatar for jflat06 216. jflat06 Lv 1 1 pt. 6,614
  7. Avatar for RAH 217. RAH Lv 1 1 pt. 5,630
  8. Avatar for azwsx123 218. azwsx123 Lv 1 1 pt. 5,630
  9. Avatar for diamond_dust 219. diamond_dust Lv 1 1 pt. 5,630
  10. Avatar for cmoyano 220. cmoyano Lv 1 1 pt. 5,630

Comments