Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,880
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,841
  3. Avatar for xkcd 13. xkcd 2 pts. 8,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,712
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,618
  6. Avatar for Sirius 2016 01 16. Sirius 2016 01 1 pt. 8,494
  7. Avatar for Bad Monkey 17. Bad Monkey 1 pt. 8,191
  8. Avatar for freefolder 18. freefolder 1 pt. 8,127
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 8,076
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 7,897

  1. Avatar for deLaCeiba 71. deLaCeiba Lv 1 16 pts. 8,925
  2. Avatar for ComputerMage 72. ComputerMage Lv 1 15 pts. 8,921
  3. Avatar for SKSbell 73. SKSbell Lv 1 15 pts. 8,920
  4. Avatar for dssb 74. dssb Lv 1 14 pts. 8,897
  5. Avatar for hansvandenhof 75. hansvandenhof Lv 1 14 pts. 8,890
  6. Avatar for Merf 76. Merf Lv 1 13 pts. 8,888
  7. Avatar for demeter900 77. demeter900 Lv 1 13 pts. 8,882
  8. Avatar for Psych0Active 78. Psych0Active Lv 1 13 pts. 8,880
  9. Avatar for Geyalust 79. Geyalust Lv 1 12 pts. 8,880
  10. Avatar for bx7gn 80. bx7gn Lv 1 12 pts. 8,870

Comments