Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,397
  2. Avatar for Contenders 2. Contenders 78 pts. 9,358
  3. Avatar for Go Science 3. Go Science 60 pts. 9,322
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,311
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 9,286
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 24 pts. 9,246
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 9,229
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,132
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 9,101
  10. Avatar for Russian team 10. Russian team 6 pts. 8,921
  1. Avatar for deLaCeiba 71. deLaCeiba Lv 1 16 pts. 8,925
  2. Avatar for ComputerMage 72. ComputerMage Lv 1 15 pts. 8,921
  3. Avatar for SKSbell 73. SKSbell Lv 1 15 pts. 8,920
  4. Avatar for dssb 74. dssb Lv 1 14 pts. 8,897
  5. Avatar for hansvandenhof 75. hansvandenhof Lv 1 14 pts. 8,890
  6. Avatar for Merf 76. Merf Lv 1 13 pts. 8,888
  7. Avatar for demeter900 77. demeter900 Lv 1 13 pts. 8,882
  8. Avatar for Psych0Active 78. Psych0Active Lv 1 13 pts. 8,880
  9. Avatar for Geyalust 79. Geyalust Lv 1 12 pts. 8,880
  10. Avatar for bx7gn 80. bx7gn Lv 1 12 pts. 8,870

Comments