Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 6,614
  1. Avatar for mcummings 91. mcummings Lv 1 8 pts. 8,822
  2. Avatar for ViJay7019 92. ViJay7019 Lv 1 8 pts. 8,822
  3. Avatar for sharondipity 93. sharondipity Lv 1 7 pts. 8,819
  4. Avatar for fryguy 94. fryguy Lv 1 7 pts. 8,808
  5. Avatar for stomjoh 95. stomjoh Lv 1 7 pts. 8,798
  6. Avatar for Mengee 96. Mengee Lv 1 7 pts. 8,778
  7. Avatar for Kiwegapa 97. Kiwegapa Lv 1 6 pts. 8,778
  8. Avatar for Anfinsen_slept_here 98. Anfinsen_slept_here Lv 1 6 pts. 8,775
  9. Avatar for Keresto 99. Keresto Lv 1 6 pts. 8,756
  10. Avatar for alcor29 100. alcor29 Lv 1 6 pts. 8,747

Comments