Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 6,614

  1. Avatar for NinjaGreg 111. NinjaGreg Lv 1 4 pts. 8,662
  2. Avatar for Nbbroo 112. Nbbroo Lv 1 4 pts. 8,652
  3. Avatar for tarimo 113. tarimo Lv 1 4 pts. 8,628
  4. Avatar for wqtraz 114. wqtraz Lv 1 3 pts. 8,627
  5. Avatar for tweak64 115. tweak64 Lv 1 3 pts. 8,621
  6. Avatar for aendgraend 116. aendgraend Lv 1 3 pts. 8,618
  7. Avatar for guineapig 117. guineapig Lv 1 3 pts. 8,602
  8. Avatar for ManVsYard 118. ManVsYard Lv 1 3 pts. 8,595
  9. Avatar for fishercat 119. fishercat Lv 1 3 pts. 8,583
  10. Avatar for monkry 120. monkry Lv 1 3 pts. 8,569

Comments