Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 6,614
  1. Avatar for rezaefar 141. rezaefar Lv 1 1 pt. 8,468
  2. Avatar for frostschutz 142. frostschutz Lv 1 1 pt. 8,465
  3. Avatar for SouperGenious 143. SouperGenious Lv 1 1 pt. 8,463
  4. Avatar for herballemon 144. herballemon Lv 1 1 pt. 8,437
  5. Avatar for boondog 145. boondog Lv 1 1 pt. 8,437
  6. Avatar for Bulder 146. Bulder Lv 1 1 pt. 8,429
  7. Avatar for Anamfija 147. Anamfija Lv 1 1 pt. 8,410
  8. Avatar for racingsnailrider 148. racingsnailrider Lv 1 1 pt. 8,393
  9. Avatar for bzipitidoo 149. bzipitidoo Lv 1 1 pt. 8,393
  10. Avatar for Inkedhands 150. Inkedhands Lv 1 1 pt. 8,384

Comments