Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 6,614
  1. Avatar for mirjamvandelft 191. mirjamvandelft Lv 1 1 pt. 7,984
  2. Avatar for Tyssel 192. Tyssel Lv 1 1 pt. 7,973
  3. Avatar for Ciccillo 193. Ciccillo Lv 1 1 pt. 7,971
  4. Avatar for andrewxc 194. andrewxc Lv 1 1 pt. 7,968
  5. Avatar for Carlos Santamaria 195. Carlos Santamaria Lv 1 1 pt. 7,960
  6. Avatar for chaichontat.s 196. chaichontat.s Lv 1 1 pt. 7,950
  7. Avatar for borisvdm 197. borisvdm Lv 1 1 pt. 7,948
  8. Avatar for val.sch67 198. val.sch67 Lv 1 1 pt. 7,927
  9. Avatar for Karsten69 199. Karsten69 Lv 1 1 pt. 7,910
  10. Avatar for A01225950 200. A01225950 Lv 1 1 pt. 7,897

Comments