Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 6,614
  1. Avatar for UserVier 201. UserVier Lv 1 1 pt. 7,896
  2. Avatar for Leashed 202. Leashed Lv 1 1 pt. 7,888
  3. Avatar for larry25427 203. larry25427 Lv 1 1 pt. 7,884
  4. Avatar for rcollie 204. rcollie Lv 1 1 pt. 7,858
  5. Avatar for Mutabis 205. Mutabis Lv 1 1 pt. 7,836
  6. Avatar for kywew3 206. kywew3 Lv 1 1 pt. 7,825
  7. Avatar for ivalnic 207. ivalnic Lv 1 1 pt. 7,783
  8. Avatar for aggeliki370 208. aggeliki370 Lv 1 1 pt. 7,521
  9. Avatar for alexdoetsch 209. alexdoetsch Lv 1 1 pt. 7,517
  10. Avatar for Carlaa 210. Carlaa Lv 1 1 pt. 7,479

Comments