Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 6,614

  1. Avatar for ZeroLeak7 31. ZeroLeak7 Lv 1 49 pts. 9,138
  2. Avatar for jermainiac 32. jermainiac Lv 1 48 pts. 9,135
  3. Avatar for frood66 33. frood66 Lv 1 47 pts. 9,134
  4. Avatar for dcrwheeler 34. dcrwheeler Lv 1 45 pts. 9,133
  5. Avatar for O Seki To 35. O Seki To Lv 1 44 pts. 9,132
  6. Avatar for mimi 36. mimi Lv 1 43 pts. 9,118
  7. Avatar for nicobul 37. nicobul Lv 1 42 pts. 9,115
  8. Avatar for randomlil 38. randomlil Lv 1 41 pts. 9,111
  9. Avatar for eusair 39. eusair Lv 1 40 pts. 9,106
  10. Avatar for pvc78 40. pvc78 Lv 1 39 pts. 9,102

Comments