Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,397
  2. Avatar for Contenders 2. Contenders 78 pts. 9,358
  3. Avatar for Go Science 3. Go Science 60 pts. 9,322
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,311
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 9,286
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 24 pts. 9,246
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 9,229
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,132
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 9,101
  10. Avatar for Russian team 10. Russian team 6 pts. 8,921
  1. Avatar for Bruno Kestemont 21. Bruno Kestemont Lv 1 63 pts. 9,211
  2. Avatar for Deleted player 22. Deleted player 61 pts. 9,199
  3. Avatar for jobo0502 23. jobo0502 Lv 1 60 pts. 9,185
  4. Avatar for Deleted player 24. Deleted player pts. 9,177
  5. Avatar for Museka 25. Museka Lv 1 57 pts. 9,175
  6. Avatar for caglar 26. caglar Lv 1 56 pts. 9,170
  7. Avatar for WBarme1234 27. WBarme1234 Lv 1 54 pts. 9,165
  8. Avatar for tokens 28. tokens Lv 1 53 pts. 9,160
  9. Avatar for gmn 29. gmn Lv 1 52 pts. 9,157
  10. Avatar for YeshuaLives 30. YeshuaLives Lv 1 50 pts. 9,144

Comments