Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,397
  2. Avatar for Contenders 2. Contenders 78 pts. 9,358
  3. Avatar for Go Science 3. Go Science 60 pts. 9,322
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,311
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 9,286
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 24 pts. 9,246
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 9,229
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,132
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 9,101
  10. Avatar for Russian team 10. Russian team 6 pts. 8,921
  1. Avatar for kabubi 61. kabubi Lv 1 21 pts. 8,975
  2. Avatar for georg137 62. georg137 Lv 1 21 pts. 8,973
  3. Avatar for gurch 63. gurch Lv 1 20 pts. 8,966
  4. Avatar for weitzen 64. weitzen Lv 1 20 pts. 8,958
  5. Avatar for smholst 65. smholst Lv 1 19 pts. 8,953
  6. Avatar for JayD7217 66. JayD7217 Lv 1 18 pts. 8,942
  7. Avatar for froggs554 67. froggs554 Lv 1 18 pts. 8,940
  8. Avatar for christioanchauvin 68. christioanchauvin Lv 1 17 pts. 8,930
  9. Avatar for carsonfb 69. carsonfb Lv 1 17 pts. 8,929
  10. Avatar for tomespen 70. tomespen Lv 1 16 pts. 8,928

Comments