Placeholder image of a protein
Icon representing a puzzle

1293: Dysferlin C2B Domain: Predicted Contacts

Closed since over 9 years ago

Intermediate

Summary

Created
October 07, 2016
Expires
Max points
100
Description

Note: This puzzle was mistakenly posted without a Contact Bonus filter. The puzzle has been closed and reposted as Puzzle 1293b.



This is a followup to Puzzle 1291, now with predicted contacts! This domain of the human dysferlin protein; see the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Players may load in solutions from Puzzle 1291.



Sequence:


DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGD

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,359
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 47 pts. 9,229
  3. Avatar for Gargleblasters 3. Gargleblasters 19 pts. 9,142
  4. Avatar for Void Crushers 4. Void Crushers 7 pts. 8,640
  5. Avatar for Contenders 5. Contenders 2 pts. 8,562
  6. Avatar for Deleted group 6. Deleted group pts. 8,132
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 1 pt. 3,218
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 1 pt. 1,822
  1. Avatar for Psych0Active 11. Psych0Active Lv 1 17 pts. 8,132
  2. Avatar for pvc78 12. pvc78 Lv 1 14 pts. 7,427
  3. Avatar for demeter900 13. demeter900 Lv 1 11 pts. 6,849
  4. Avatar for dbuske 14. dbuske Lv 1 9 pts. 6,440
  5. Avatar for Mike Cassidy 15. Mike Cassidy Lv 1 7 pts. 6,292
  6. Avatar for chaoseclipse01 16. chaoseclipse01 Lv 1 5 pts. 5,543
  7. Avatar for Arne Heessels 17. Arne Heessels Lv 1 4 pts. 5,178
  8. Avatar for fishercat 18. fishercat Lv 1 3 pts. 4,315
  9. Avatar for jermainiac 19. jermainiac Lv 1 2 pts. 3,755
  10. Avatar for JUMELLE54 20. JUMELLE54 Lv 1 2 pts. 3,750

Comments